PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_013604892.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family GATA
Protein Properties Length: 287aa    MW: 32252.3 Da    PI: 8.8063
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_013604892.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA62.16.6e-20206240135
            GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35 
                     C +C tt+Tp+WR+gp+g+ktLCnaCG+++r+ +l
  XP_013604892.1 206 CNHCETTETPQWREGPNGPKTLCNACGVRFRSGRL 240
                     *******************************9885 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF577165.23E-15199262No hitNo description
Gene3DG3DSA:3.30.50.106.5E-15200237IPR013088Zinc finger, NHR/GATA-type
SMARTSM004014.4E-18200250IPR000679Zinc finger, GATA-type
PROSITE profilePS5011411.978200236IPR000679Zinc finger, GATA-type
CDDcd002021.02E-16205262No hitNo description
PROSITE patternPS003440206231IPR000679Zinc finger, GATA-type
PfamPF003208.7E-18206240IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 287 aa     Download sequence    Send to blast
MMNWLPEEGL TADDFFDDFI NTIDFPLQDI DDVTTNGEVE DWEAKFQHLE PPPMDVFTSF  60
PSEFTSSCGV NRLGPLGTVP VLKQSGACGA LSGINSSTLH QASSPHDIKV SKLFQSLSPV  120
SVFESNYASF SPQDSRSQRM TSPVKGMRSK RKRPTPTPVR FKYLHSFEAS KPEKLTPGES  180
GFRTYYAFEQ HAKKGRKISS QVTRKCNHCE TTETPQWREG PNGPKTLCNA CGVRFRSGRL  240
VPEYRPASSP TFVPSVHSNS HRKIMEMRRN EGDQFHTKMI HGMISRA
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1895180.0AC189518.2 Brassica rapa subsp. pekinensis cultivar Inbred line 'Chiifu' clone KBrB090M17, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013729511.10.0PREDICTED: GATA transcription factor 11-like isoform X1
RefseqXP_013604892.10.0PREDICTED: GATA transcription factor 11-like
SwissprotQ6DBP81e-117GAT11_ARATH; GATA transcription factor 11
TrEMBLA0A078H2G70.0A0A078H2G7_BRANA; BnaC08g02370D protein
TrEMBLA0A0D3DJD90.0A0A0D3DJD9_BRAOL; Uncharacterized protein
STRINGBra030709.1-P1e-167(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM16812589
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G08010.21e-113GATA transcription factor 11